New England Biolabs
To access your account, log in or register.
Products Technical Reference Customer Service My NEB Account
Contact NEB About Us Site Map Request a Catalog OEM at NEB ISO International Orders Freezer Program Quick Order
Ava DnaE-n Intein
Intein Name Ava DnaE-n
Prototype Allele Ssp DnaE-n
Extein Name DnaE pol subunit, DNA polymerase III alpha subunit
Intein Class Theoretical
Organism Name Anabaena variabilis ATCC29413
Organism Description Cyanobacterium, taxon:240292
Domain of Life Eubacteria
Endonuclease Activity
Endo Motif None
Location in Extein Y775
Insert Site Comments dnaE-a, Beta and tau binding domains
Intein Size (aa) 103
Intein N-terminal FEDMLKFAEY/C
Intein C-terminal SN/CFNKSHSTAY
Accession No. ZP_00159367 in NCBI/protein, Avar03004654, Ava_1603
Intein aa Sequence >gi|53763831|ref|ZP_00159367.2|[53763831] Ava DnaE-n N-terminal intein fragment (including -1 extein residue)
YCLSYDTEVLTVEYGFVPIGEIVDKGIECSVFSIDSNGIVYTQPIAQWHHRGKQEVFEYCLEDGSIIKATKDHKFMTQDG
KMLPIDEIFEQELDLLQVKGLPE
Block A CLSYDTEVLTVEY N13
Block B GSIIKATKDHKFMT N76
Block C None
Block D None
Block E None
Block H None
Block F
Block G
Initially Contributed by Fran Perler
Contributor's Address
Contributor's Phone No.
Contributor's FAX No.
Contributor's Email address
Independently Found By
Comments This DnaE intein is a natuarlly split intein. Homolog of the catalytic alpha subunit of E. coli DNA polymerase III. BLOCKS A & B ARE IN Fragment N AND BLOCKS F & G ARE IN Fragment C.
Date Submitted 03/03/2005
References Kaneko 2001

Last database update: 11/05/10

InBase Home Background Info Splicing mechanism Splicing motifs DOD Endo motifs
Intein registry Intein alleles Selected properties Blast against InBase  
Do you have an intein? Submitting data Bibliography Intein links NEB Home