| Intein Name |
Aov DnaE-n |
| Prototype Allele |
Ssp DnaE-n |
| Extein Name |
DnaE pol subunit, DNA polymerase III alpha subunit |
| Intein Class |
Theoretical |
| Organism Name |
Aphanizomenon ovalisporum |
| Organism Description |
Cyanobacterium, taxon:75695 |
| Domain of Life |
Eubacteria |
| Endonuclease Activity |
|
| Endo Motif |
None |
| Location in Extein |
Y402 |
| Insert Site Comments |
dnaE-a, Beta and tau binding domains |
| Intein Size (aa) |
101 |
| Intein N-terminal |
FQQMLNFAEY/C |
| Intein C-terminal |
SN/CFNKSHSTAY |
| Accession No. |
AAP47636 in NCBI/protein, |
| Intein aa Sequence |
>gi|37784570|gb|AAP47636.1|[37784570] Aov DnaE-n N-terminal intein fragment (including -1 extein residue)
YCLSADTEILTVEYGFLPIGEIVGKAIECRVYSVDGNGNIYTQSIAQWHNRGEQEVFEYT
LEDGSIIRATKDHKFMTTDGEMLPIDEXFARQLDLMQVQGLH |
| Block A |
CLSADTEILTVEY N13 |
| Block B |
GSIIRATKDHKFMT N76 |
| Block C |
None |
| Block D |
None |
| Block E |
None |
| Block H |
None |
| Block F |
|
| Block G |
|
| Initially Contributed by |
Fran Perler |
| Contributor's Address |
|
| Contributor's Phone No. |
|
| Contributor's FAX No. |
|
| Contributor's Email address |
|
| Independently Found By |
|
| Comments |
This DnaE intein is a natuarlly split intein. Homolog of the catalytic alpha subunit of E. coli DNA polymerase III. BLOCKS A & B ARE IN Fragment N AND BLOCKS F & G ARE IN Fragment C. |
| Date Submitted |
02/22/2005 |
| References |
Caspi 2003 |