| Intein Name | Mhu Pol-II | 
| Prototype Allele | Pho Pol-II | 
| Extein Name | DNA polymerase II, DP2 subunit | 
| Intein Class | Theoretical | 
| Organism Name | Methanospirillum hungateii JF-1 | 
| Organism Description | taxon 323259 | 
| Domain of Life | Archaea | 
| Endonuclease Activity |  | 
| Endo Motif | None | 
| Location in Extein | N872 | 
| Insert Site Comments | pol_II-a | 
| Intein Size (aa) | 165 | 
| Intein N-terminal | PFFHAAKRRN/C | 
| Intein C-terminal | GQ/CDGDEDCVML | 
| Accession No. | ABD42136 in NCBI/Protein, Mhun_2435 | 
| Intein aa Sequence | >gi|88189139|gb|ABD42136.1|[88189139] | Mhu Pol-II intein (including -1 and +1 extein residues) NCFHGDTLIEIYADGILEEIPIRRFVLEHLDLSQAGVDALGTFYADPVRPAHVRSVDTGGIPHLRKITSVSVHKAPANLI
 QFSTSRGKNLLVTPDHAMLVWDVSYLRKIRALEVKIGDAVPVWESGVVISDRIVSIDYVPCEDERVYCLTVDRDHNVVGN
 GIFTGQC
 | 
| Block A | CFHGDTLIEIYAD 13 | 
| Block B | GKNLLVTPDHAMLV 99 | 
| Block C | None | 
| Block D | None | 
| Block E | None | 
| Block H | None | 
| Block F | RVYCLTV**DRDHNVV 157 | 
| Block G | NGIFTGQC 166 | 
| Initially Contributed by | Shmuel Pietrokovski | 
| Contributor's Address |  | 
| Contributor's Phone No. |  | 
| Contributor's FAX No. |  | 
| Contributor's Email address | shmuel.pietrokovski@weizmann.ac.il | 
| Independently Found By |  | 
| Comments |  | 
| Date Submitted | 04/14/2005 | 
| References |  |