New England Biolabs
To access your account, log in or register.
Products Technical Reference Customer Service My NEB Account
Contact NEB About Us Site Map Request a Catalog OEM at NEB ISO International Orders Freezer Program Quick Order
Ssp DnaE-c Intein
Intein Name Ssp DnaE-c
Prototype Allele Ssp DnaE-c
Extein Name DnaE pol subunit, DNA polymerase III alpha subunit
Intein Class Experimental
Organism Name Synechocystis species, strain PCC6803
Organism Description Cyanobacterium, taxon:1148
Domain of Life Eubacteria
Endonuclease Activity
Endo Motif None
Location in Extein None
Insert Site Comments dnaE-a, Beta and tau binding domains
Intein Size (aa) 36
Intein N-terminal FDQMVKFAEY/C
Intein C-terminal AN/CFNKSHSTAY
Accession No. S75328 in NCBI/protein, sll1572
Intein aa Sequence >gi|7469302|pir||S75328[7469302] Ssp DnaE-c C-terminal intein fragment (including +1 extein residue)
MVKVIGRRSLGVQRIFDIGLPQDHNFLLANGAIAANC
Block A
Block B
Block C None
Block D None
Block E None
Block H None
Block F RIFDIGL**PQDHNFL C27
Block G NGAIAANC C37
Initially Contributed by Paul Xiang-Qin Liu
Contributor's Address Biochemistry Department
Dalhousie University
Halifax, Nova Scotia B3H 4H7
Canada
Contributor's Phone No. 902-494-1208
Contributor's FAX No. 902-494-1355
Contributor's Email address pxqliu@dal.ca
Independently Found By Independently identified as a theoretical intein in Gorbalenya 98.
Comments The Ssp DnaE intein is a split intein capable of protein trans-splicing. Homolog of the catalytic alpha subunit of E. coli DNA polymerase III. The C-terminal penultimate His residue is replaced by Ala.
See AF545504.1 which is optimized for plant codons (Yang 03).BLOCKS A & B ARE IN Fragment N AND BLOCKS F & G ARE IN Fragment C.
Date Submitted 06/10/1998
References Kaneko 1995
Keneko 1995B
Kaneko 1996
Kaneko 1996B
Kaneko 1997
Gorbalenya 1998
Wu 1998
Perler 1999B
Scott 1999
Evans 2000
Ozawa 2000
Martin 2001
Chen 2001
Sun 2001
Iwai 2001
Mills 2001
Ghosh 2001
Ozawa 2001
Chen 2002B
Nichols 2003
Yang 2003
Chin 2003
Caspi 2003
Zuger 2005
Iwai 2006
Aranko 2009

Last database update: 11/05/10

InBase Home Background Info Splicing mechanism Splicing motifs DOD Endo motifs
Intein registry Intein alleles Selected properties Blast against InBase  
Do you have an intein? Submitting data Bibliography Intein links NEB Home