| Intein Name |
Ssp-PCC7002 DnaE-c |
| Prototype Allele |
Ssp DnaE-c |
| Extein Name |
DnaE pol subunit, DNA polymerase III alpha subunit |
| Intein Class |
Experimental |
| Organism Name |
Synechocystis species, strain PCC 7002 |
| Organism Description |
Cyanobacterium, taxon: 32049 |
| Domain of Life |
Eubacteria |
| Endonuclease Activity |
|
| Endo Motif |
None |
| Location in Extein |
None |
| Insert Site Comments |
dnaE-a, Beta and tau binding domains |
| Intein Size (aa) |
36 |
| Intein N-terminal |
FDQMVKFAEY/C |
| Intein C-terminal |
AN/CFNKSHSTAY |
| Accession No. |
YP_001735617.1 in NCBI/protein,/locus_tag="SYNPCC7002_A2384", A2384 in Cyanobase |
| Intein aa Sequence |
>YP_001735617.1 GI:170078979 | Ssp-PCC7002 DnaE-c C-terminal intein fragment (including +1 extein residue)
MVKIIRRKFIGHAPTYDIGLSQDHNFLLGQGLIAANC |
| Block A |
|
| Block B |
|
| Block C |
None |
| Block D |
None |
| Block E |
None |
| Block H |
None |
| Block F |
PTYDIGL**SQDHNFL C27 |
| Block G |
QGLIAANC C37 |
| Initially Contributed by |
Gerrit Volkmann |
| Contributor's Address |
|
| Contributor's Phone No. |
|
| Contributor's FAX No. |
|
| Contributor's Email address |
gr996166@dal.ca |
| Independently Found By |
|
| Comments |
The genome of Synechococcus ssp. PCC7002 seems devoid of any other inteins found frequently in cyanobacteria (e.g. in dnaB, gyrB or dnaX genes)(GV). |
| Date Submitted |
04/10/2010 |
| References |
|
