| Intein Name |
Npu-PCC73102 DnaE-n |
| Prototype Allele |
Ssp DnaE-n |
| Extein Name |
DnaE pol subunit, DNA polymerase III alpha subunit |
| Intein Class |
Experimental |
| Organism Name |
Nostoc punctiforme PCC73102 |
| Organism Description |
Cyanobacterium,taxon:63737, ATCC29133 |
| Domain of Life |
Eubacteria |
| Endonuclease Activity |
|
| Endo Motif |
None |
| Location in Extein |
Y774 |
| Insert Site Comments |
dnaE-a, Beta and tau binding domains |
| Intein Size (aa) |
102 |
| Intein N-terminal |
FEQMLKFAEY/C |
| Intein C-terminal |
SN/CFNKSHSTAY |
| Accession No. |
ZP_00111398 in NCBI/protein, Npun5871 |
| Intein aa Sequence |
>gi|23129572|ref|ZP_00111398.1|[23129572]ZP_00111398 | Npu-PCC73102 DnaE-n N-terminal intein fragment (including -1 extein residue)
YCLSYETEILTVEYGLLPIGKIVEKRIECTVYSVDNNGNIYTQPVAQWHDRGEQEVFEYCLEDGSLIRATKDH
KFMTVDGQMLPIDEIFERELDLMRVDNLPN |
| Block A |
CLSYETEILTVEY N13 |
| Block B |
GSVIRATSDHRFLT N76 |
| Block C |
None |
| Block D |
None |
| Block E |
None |
| Block H |
None |
| Block F |
|
| Block G |
|
| Initially Contributed by |
Olga A. Zhaxybayeva, Alireza G. Senejani & Johann P. Gogarten |
| Contributor's Address |
Johann P. Gogarten
Dept. of Molecular and Cell Biology
University of Connecticut
75, North Eagleville Rd, Unit 3044
Storrs, CT 06269 USA
http://www.sp.uconn.edu/~gogarten/USA |
| Contributor's Phone No. |
1-860-486-4061 |
| Contributor's FAX No. |
1-860-486-1784 |
| Contributor's Email address |
Gogarten@uconn.edu |
| Independently Found By |
|
| Comments |
This DnaE intein is a natuarlly split intein. Homolog of the catalytic alpha subunit of E. coli DNA polymerase III. BLOCKS A & B ARE IN Fragment N AND BLOCKS F & G ARE IN Fragment C. |
| Date Submitted |
09/13/2001 |
| References |
Caspi 2003
Iwao 2006
Dassa 2007
Wei 2006
Zettler 2009
Oeemig 2009
Aranko 2009
Heinamaki 2009 |
