New England Biolabs
To access your account, log in or register.
Products Technical Reference Customer Service My NEB Account
Contact NEB About Us Site Map Request a Catalog OEM at NEB ISO International Orders Freezer Program Quick Order
Npu-PCC73102 DnaE-n Intein
Intein Name Npu-PCC73102 DnaE-n
Prototype Allele Ssp DnaE-n
Extein Name DnaE pol subunit, DNA polymerase III alpha subunit
Intein Class Experimental
Organism Name Nostoc punctiforme PCC73102
Organism Description Cyanobacterium,taxon:63737, ATCC29133
Domain of Life Eubacteria
Endonuclease Activity
Endo Motif None
Location in Extein Y774
Insert Site Comments dnaE-a, Beta and tau binding domains
Intein Size (aa) 102
Intein N-terminal FEQMLKFAEY/C
Intein C-terminal SN/CFNKSHSTAY
Accession No. ZP_00111398 in NCBI/protein, Npun5871
Intein aa Sequence >gi|23129572|ref|ZP_00111398.1|[23129572]ZP_00111398 | Npu-PCC73102 DnaE-n N-terminal intein fragment (including -1 extein residue)
YCLSYETEILTVEYGLLPIGKIVEKRIECTVYSVDNNGNIYTQPVAQWHDRGEQEVFEYCLEDGSLIRATKDH
KFMTVDGQMLPIDEIFERELDLMRVDNLPN
Block A CLSYETEILTVEY N13
Block B GSVIRATSDHRFLT N76
Block C None
Block D None
Block E None
Block H None
Block F
Block G
Initially Contributed by Olga A. Zhaxybayeva, Alireza G. Senejani & Johann P. Gogarten
Contributor's Address Johann P. Gogarten
Dept. of Molecular and Cell Biology
University of Connecticut
75, North Eagleville Rd, Unit 3044
Storrs, CT 06269 USA
http://www.sp.uconn.edu/~gogarten/USA
Contributor's Phone No. 1-860-486-4061
Contributor's FAX No. 1-860-486-1784
Contributor's Email address Gogarten@uconn.edu
Independently Found By
Comments This DnaE intein is a natuarlly split intein. Homolog of the catalytic alpha subunit of E. coli DNA polymerase III. BLOCKS A & B ARE IN Fragment N AND BLOCKS F & G ARE IN Fragment C.
Date Submitted 09/13/2001
References Caspi 2003
Iwao 2006
Dassa 2007
Wei 2006
Zettler 2009
Oeemig 2009
Aranko 2009
Heinamaki 2009

Last database update: 11/05/10

InBase Home Background Info Splicing mechanism Splicing motifs DOD Endo motifs
Intein registry Intein alleles Selected properties Blast against InBase  
Do you have an intein? Submitting data Bibliography Intein links NEB Home