| Intein Name |
Msp-KMS DnaB |
| Prototype Allele |
Mle-TN DnaB |
| Extein Name |
DnaB helicase |
| Intein Class |
Theoretical |
| Organism Name |
Mycobacterium species KMS |
| Organism Description |
taxon:189918 |
| Domain of Life |
Eubacteria |
| Endonuclease Activity |
|
| Endo Motif |
DOD |
| Location in Extein |
K233 |
| Insert Site Comments |
dnaB-b, ATP/GTP-binding site motif A (P-loop) |
| Intein Size (aa) |
322 |
| Intein N-terminal |
VIAARPGMGK/A |
| Intein C-terminal |
HN/STLGLDFMRS |
| Accession No. |
ZP_01282514 in NCBI/protein, Mkms_5455, MkmsDRAFT_4958 |
| Intein aa Sequence |
>gi|92913886|ref|ZP_01282514.1|ABL94640.1[92913886] Msp-KMS DnaB intein (including -1 and +1 extein residues)
KALALDTPLPTPDGWTTMGEVEVGDELIGADGRPTRVVAATDVMVGRPCYEVEFSDGTVIVADAQHQWLTDTRASGRSAR
VAAAVRTTEQIAATLRCPTADRRLNHSVANAAPLQAPTRELLVPPYTLGAWLGDGTSAAAQITTADPELVMRIEAEGVEF
GTLQGRLRTIGVLGDKHIPIEYLRASESQRRALLAGLLDTDGTVAVGGGVQFSVTNKRLAADVAELVVSLGYRCRSTTKH
VKGRSADSSVAYTLNFSTDDDVFGLARKAILHKERRGASTTVRSDSRFIVDVRPVRSVPVRCVEVSNDSHMYLAGRSMVP
THNS |
| Block A |
ALALDTPLPTPDG 13 |
| Block B |
GTVIVADAQHQWLT 69 |
| Block C |
TLGAWLGDG 134 |
| Block D |
DKHIPIEY 181 |
| Block E |
LLAGLLDTDG 201 |
| Block H |
VTNKRLAADVAELVVSLGY 231 |
| Block F |
PVRCVEV*SNDSHMYL 312 |
| Block G |
SMVPTHNS 323 |
| Initially Contributed by |
Fran Perler |
| Contributor's Address |
|
| Contributor's Phone No. |
|
| Contributor's FAX No. |
|
| Contributor's Email address |
|
| Independently Found By |
|
| Comments |
|
| Date Submitted |
07/10/2006 |
| References |
|
|