| Intein Name |
Ccy Hyp1-Csp-1 |
| Prototype Allele |
Ccy Hyp1-Csp-1 |
| Extein Name |
Hypothetical, UPF0027-containing protein |
| Intein Class |
Theoretical |
| Organism Name |
Cyanothece sp. CCY0110 |
| Organism Description |
Cyanobacterium, taxon:391612 |
| Domain of Life |
Eubacteria |
| Endonuclease Activity |
|
| Endo Motif |
None |
| Location in Extein |
G77 |
| Insert Site Comments |
Hyp1_Csp-a |
| Intein Size (aa) |
194 |
| Intein N-terminal |
IPAAVGVDIG/C |
| Intein C-terminal |
HN/CGMAAIKTPY |
| Accession No. |
EAZ88681.1 in NCBI/Protein, locus_tag="CY0110_12402" |
| Intein aa Sequence |
>EAZ88681.1 GI:126617907 | AAXW01000071.1 | Ccy Hyp1-Csp-1 intein including -1 and +1 extein residues)
GCFTGDTLIPLVDGKSYPIQQLAEEKQAIYIYACTPTGRIVASEAIARKTRKNAPLIKVILDNGEEIKCTPDHQFMLRDG
NYIEACGLKAGTSLMPFYSKTDKDGYTLIKQNYSERWQKVNEIITKSGINKKSLNLIQTNTIKSTKTIHNHRKYQHGYNH
KVVSVIPLSVTEDVYCLTVPEYNNFALSAGVFVHNC |
| Block A |
CFTGDTLIPLVDG 13 |
| Block B |
GEEIKCTPDHQFML 76 |
| Block C |
None |
| Block D |
None |
| Block E |
None |
| Block H |
None |
| Block F |
DVYCLTV**PEYNNFA 185 |
| Block G |
AGVFVHNC 195 |
| Initially Contributed by |
Fran Perler |
| Contributor's Address |
|
| Contributor's Phone No. |
|
| Contributor's FAX No. |
|
| Contributor's Email address |
|
| Independently Found By |
|
| Comments |
|
| Date Submitted |
10/30/2008 |
| References |
|
|