| Intein Name |
Tel DnaE-c |
| Prototype Allele |
Ssp DnaE-c |
| Extein Name |
DnaE pol subunit, DNA polymerase III alpha subunit |
| Intein Class |
Theoretical |
| Organism Name |
Thermosynechococcus elongatus BP-1 |
| Organism Description |
Cyanobacterium, taxon:197221 |
| Domain of Life |
Eubacteria |
| Endonuclease Activity |
|
| Endo Motif |
None |
| Location in Extein |
None |
| Insert Site Comments |
dnaE-a, Beta and tau binding domains |
| Intein Size (aa) |
35 |
| Intein N-terminal |
FKQMLDFAEY/C |
| Intein C-terminal |
AN/CFNKSHSTAY |
| Accession No. |
BAC09621.1 in NCBI/protein, tll2069 |
| Intein aa Sequence |
>gi|22295796|dbj|BAC09621.1|[22295796] Tel DnaE-c C-terminal intein fragment (including +1 extein residue)
MKIVGRRLMGWQAVYDIGLAADHNFVLANGAIAANC |
| Block A |
|
| Block B |
|
| Block C |
None |
| Block D |
None |
| Block E |
None |
| Block H |
None |
| Block F |
AVYDIGL**AADHNFV C25 |
| Block G |
NGAIAANC C36 |
| Initially Contributed by |
Fran Perler |
| Contributor's Address |
|
| Contributor's Phone No. |
|
| Contributor's FAX No. |
|
| Contributor's Email address |
|
| Independently Found By |
|
| Comments |
This DnaE intein is a natuarlly split intein. Homolog of the catalytic alpha subunit of E. coli DNA polymerase III.
BLOCKS A & B ARE IN Fragment N AND BLOCKS F & G ARE IN Fragment C. |
| Date Submitted |
04/28/2003 |
| References |
Nakamura 2002A
Nakamura 2002B
Caspi 2003 |