New England Biolabs
To access your account, log in or register.
Products Technical Reference Customer Service My NEB Account
Contact NEB About Us Site Map Request a Catalog OEM at NEB ISO International Orders Freezer Program Quick Order
Mcht-PCC7420 DnaE-2c Intein
Intein Name Mcht-PCC7420 DnaE-2c
Prototype Allele Ssp DnaE-c
Extein Name DnaE pol subunit, DNA polymerase III alpha subunit
Intein Class Theoretical
Organism Name Microcoleus chthonoplastes PCC7420
Organism Description Cyanobacterium, taxon:118168
Domain of Life Eubacteria
Endonuclease Activity
Endo Motif None
Location in Extein None
Insert Site Comments dnaE-a, Beta and tau binding domains
Intein Size (aa) 36
Intein N-terminal FEQMILFAEY/C
Intein C-terminal SN/CFNKSHSTAY
Accession No. ZP_05027420 in NCBI/protein, MC7420_6229
Intein aa Sequence >ZP_05027420| Mcht-PCC7420 DnaE-2c CC-terminal intein fragment (including +1 extein residue)
MVKIVRRQSLGVQNVYDIGVEKDHNFCLASGEIASNC
Block A
Block B
Block C None
Block D None
Block E None
Block H None
Block F PVYDIGV**ERDHNFL N27
Block G NGSVASNC N37
Initially Contributed by Fran Perler
Contributor's Address
Contributor's Phone No.
Contributor's FAX No.
Contributor's Email address
Independently Found By
Comments The annotated genome sequence probably has an error that removes the initiating Met of the intein, so the annotated sequence doesn't include the intein fragment.
Date Submitted 08/04/2009
References

Last database update: 11/05/10

InBase Home Background Info Splicing mechanism Splicing motifs DOD Endo motifs
Intein registry Intein alleles Selected properties Blast against InBase  
Do you have an intein? Submitting data Bibliography Intein links NEB Home