| Intein Name |
Mcht-PCC7420 DnaE-2c |
| Prototype Allele |
Ssp DnaE-c |
| Extein Name |
DnaE pol subunit, DNA polymerase III alpha subunit |
| Intein Class |
Theoretical |
| Organism Name |
Microcoleus chthonoplastes PCC7420 |
| Organism Description |
Cyanobacterium, taxon:118168 |
| Domain of Life |
Eubacteria |
| Endonuclease Activity |
|
| Endo Motif |
None |
| Location in Extein |
None |
| Insert Site Comments |
dnaE-a, Beta and tau binding domains |
| Intein Size (aa) |
36 |
| Intein N-terminal |
FEQMILFAEY/C |
| Intein C-terminal |
SN/CFNKSHSTAY |
| Accession No. |
ZP_05027420 in NCBI/protein, MC7420_6229 |
| Intein aa Sequence |
>ZP_05027420| Mcht-PCC7420 DnaE-2c CC-terminal intein fragment (including +1 extein residue)
MVKIVRRQSLGVQNVYDIGVEKDHNFCLASGEIASNC |
| Block A |
|
| Block B |
|
| Block C |
None |
| Block D |
None |
| Block E |
None |
| Block H |
None |
| Block F |
PVYDIGV**ERDHNFL N27 |
| Block G |
NGSVASNC N37 |
| Initially Contributed by |
Fran Perler |
| Contributor's Address |
|
| Contributor's Phone No. |
|
| Contributor's FAX No. |
|
| Contributor's Email address |
|
| Independently Found By |
|
| Comments |
The annotated genome sequence probably has an error that removes the initiating Met of the intein, so the annotated sequence doesn't include the intein fragment. |
| Date Submitted |
08/04/2009 |
| References |
|
