| Intein Name |
Ter DnaE-3n |
| Prototype Allele |
Ssp DnaE-n |
| Extein Name |
DnaE pol subunit, DNA polymerase III alpha subunit |
| Intein Class |
Theoretical |
| Organism Name |
Trichodesmium erythraeum IMS101 |
| Organism Description |
Cyanobacterium, taxon:203124 |
| Domain of Life |
Eubacteria |
| Endonuclease Activity |
|
| Endo Motif |
None |
| Location in Extein |
Y2582 |
| Insert Site Comments |
dnaE-a, Beta and tau binding domains |
| Intein Size (aa) |
102 |
| Intein N-terminal |
FEQMIKFAEY/C |
| Intein C-terminal |
SN/CFNKSHSTAY |
| Accession No. |
ABG51145 in NCBI/protein, Tery_1889,Tery02003047 |
| Intein aa Sequence |
>GI:110166605 | ABG51145 | Ter DnaE-3n N-terminal intein fragment (including -1 extein residue)
YCLTYETEIMTVEYGPLPIGKIVEYRIECTVYTVDKNGYIYTQPIAQWHNRGMQEVYEYS
LEDGTVIRATPEHKFMTEDGQMLPIDEIFERNLDLKCLGTLE |
| Block A |
CLTYETEIMTVEY N13 |
| Block B |
GTVIRATPEHKFMT N76 |
| Block C |
None |
| Block D |
None |
| Block E |
None |
| Block H |
None |
| Block F |
|
| Block G |
|
| Initially Contributed by |
Paul Liu |
| Contributor's Address |
|
| Contributor's Phone No. |
|
| Contributor's FAX No. |
|
| Contributor's Email address |
|
| Independently Found By |
|
| Comments |
This DnaE intein is a natuarlly split intein. Homolog of the catalytic alpha subunit of E. coli DNA polymerase III.
BLOCKS A & B ARE IN Fragment N AND BLOCKS F & G ARE IN Fragment C.
This sequence replaces the previous genome shotgun sequence submitted by Paul Liu to InBase from ZP_00075043.1 in NCBI/protein, Tery4385. This new sequence is identical to the previous sequence. |
| Date Submitted |
04/28/2003 |
| References |
Liu 2003
Caspi 2003 |
