New England Biolabs
To access your account, log in or register.
Products Technical Reference Customer Service My NEB Account
Contact NEB About Us Site Map Request a Catalog OEM at NEB ISO International Orders Freezer Program Quick Order
Ter DnaE-3n Intein
Intein Name Ter DnaE-3n
Prototype Allele Ssp DnaE-n
Extein Name DnaE pol subunit, DNA polymerase III alpha subunit
Intein Class Theoretical
Organism Name Trichodesmium erythraeum IMS101
Organism Description Cyanobacterium, taxon:203124
Domain of Life Eubacteria
Endonuclease Activity
Endo Motif None
Location in Extein Y2582
Insert Site Comments dnaE-a, Beta and tau binding domains
Intein Size (aa) 102
Intein N-terminal FEQMIKFAEY/C
Intein C-terminal SN/CFNKSHSTAY
Accession No. ABG51145 in NCBI/protein, Tery_1889,Tery02003047
Intein aa Sequence >GI:110166605 | ABG51145 | Ter DnaE-3n N-terminal intein fragment (including -1 extein residue)
YCLTYETEIMTVEYGPLPIGKIVEYRIECTVYTVDKNGYIYTQPIAQWHNRGMQEVYEYS
LEDGTVIRATPEHKFMTEDGQMLPIDEIFERNLDLKCLGTLE
Block A CLTYETEIMTVEY N13
Block B GTVIRATPEHKFMT N76
Block C None
Block D None
Block E None
Block H None
Block F
Block G
Initially Contributed by Paul Liu
Contributor's Address
Contributor's Phone No.
Contributor's FAX No.
Contributor's Email address
Independently Found By
Comments This DnaE intein is a natuarlly split intein. Homolog of the catalytic alpha subunit of E. coli DNA polymerase III.
BLOCKS A & B ARE IN Fragment N AND BLOCKS F & G ARE IN Fragment C.
This sequence replaces the previous genome shotgun sequence submitted by Paul Liu to InBase from ZP_00075043.1 in NCBI/protein, Tery4385. This new sequence is identical to the previous sequence.
Date Submitted 04/28/2003
References Liu 2003
Caspi 2003

Last database update: 11/05/10

InBase Home Background Info Splicing mechanism Splicing motifs DOD Endo motifs
Intein registry Intein alleles Selected properties Blast against InBase  
Do you have an intein? Submitting data Bibliography Intein links NEB Home