| Intein Name |
Sel-PCC6301 DnaE-n |
| Prototype Allele |
Ssp DnaE-n |
| Extein Name |
DnaE pol subunit, DNA polymerase III alpha subunit |
| Intein Class |
Theoretical |
| Organism Name |
Synechococcus elongatus PCC 6301 |
| Organism Description |
Cyanobacterium, taxon:269084"Berkely strain 6301~equivalent name: Synechococcus
sp. PCC 6301~synonym: Anacystis nudulans" |
| Domain of Life |
Eubacteria |
| Endonuclease Activity |
|
| Endo Motif |
None |
| Location in Extein |
Y757 |
| Insert Site Comments |
dnaE-a, Beta and tau binding domains |
| Intein Size (aa) |
113 |
| Intein N-terminal |
FDQMVLFAEY/C |
| Intein C-terminal |
SN/CFNKSHSTAY |
| Accession No. |
YP_172608 in NCBI/protein, syc1898_d |
| Intein aa Sequence |
>gi|56751907|ref|YP_172608.1|[56751907] Sel-PCC6301 DnaE-n N-terminal intein fragment (including -1 extein residue)
YCLAADTEVLTVEYGPIAIGKLVEENIRCQVYCCNPDGYIYSQPIGQWHQRGEQEVIEYELSDGRIIRATADHRFMTEEG
EMLSLDEIFERSLELKQIPTPLLAIAQPSPLATA |
| Block A |
CLAADTEVLTVEY N13 |
| Block B |
GRIIRATADHRFMT N76 |
| Block C |
None |
| Block D |
None |
| Block E |
None |
| Block H |
None |
| Block F |
|
| Block G |
|
| Initially Contributed by |
Fran Perler |
| Contributor's Address |
|
| Contributor's Phone No. |
|
| Contributor's FAX No. |
|
| Contributor's Email address |
|
| Independently Found By |
|
| Comments |
This DnaE intein is a natuarlly split intein. Homolog of the catalytic alpha subunit of E. coli DNA polymerase III. BLOCKS A & B ARE IN Fragment N AND BLOCKS F & G ARE IN Fragment C. |
| Date Submitted |
02/22/2005 |
| References |
|
