New England Biolabs
To access your account, log in or register.
Products Technical Reference Customer Service My NEB Account
Contact NEB About Us Site Map Request a Catalog OEM at NEB ISO International Orders Freezer Program Quick Order
Asp DnaE-c Intein
Intein Name Asp DnaE-c
Prototype Allele Ssp DnaE-c
Extein Name DnaE pol subunit, DNA polymerase III alpha subunit
Intein Class Experimental
Organism Name Anabaena species PCC7120, (Nostoc sp. PCC7120)
Organism Description Cyanobacterium, Nitrogen-fixing, taxon:103690
Domain of Life Eubacteria
Endonuclease Activity
Endo Motif None
Location in Extein None
Insert Site Comments dnaE-a, Beta and tau binding domains
Intein Size (aa) 36
Intein N-terminal FDDMLKFAEY/C
Intein C-terminal SN/CFNKSHSTAY
Accession No. NP_485097.1 in NCBI/protein, alr1054
Intein aa Sequence >gi|17228549|ref|NP_485097.1|[17228549] Asp DnaE-c C-terminal intein fragment (including +1 extein residue)
MIKIASRKFLGVENVYDIGVRRDHNFFIKNGLIASNC
Block A
Block B
Block C None
Block D None
Block E None
Block H None
Block F NVYDIGV**RRDHNFF C27
Block G NGLIASNC C37
Initially Contributed by Fran Perler
Contributor's Address
Contributor's Phone No.
Contributor's FAX No.
Contributor's Email address
Independently Found By
Comments This DnaE intein is a natuarlly split intein. Homolog of the catalytic alpha subunit of E. coli DNA polymerase III. BLOCKS A & B ARE IN Fragment N AND BLOCKS F & G ARE IN Fragment C.
Date Submitted 07/07/2002
References Kaneko 2001
Caspi 2003
Wei 2006

Last database update: 11/05/10

InBase Home Background Info Splicing mechanism Splicing motifs DOD Endo motifs
Intein registry Intein alleles Selected properties Blast against InBase  
Do you have an intein? Submitting data Bibliography Intein links NEB Home