New England Biolabs
To access your account, log in or register.
Products Technical Reference Customer Service My NEB Account
Contact NEB About Us Site Map Request a Catalog OEM at NEB ISO International Orders Freezer Program Quick Order
Neq Pol-c Intein
Intein Name Neq Pol-c
Prototype Allele Tli Pol-2
Extein Name DNA polymerase (alpha or family B)
Intein Class Experimental
Organism Name Nanoarchaeum equitans Kin4-M
Organism Description Thermophile, taxon:228908
Domain of Life Archaea
Endonuclease Activity
Endo Motif None
Location in Extein None
Insert Site Comments pol-c, Pol Motif C
Intein Size (aa) 30
Intein N-terminal EEGFKVIYGD/S
Intein C-terminal HN/TDSLFISGDK
Accession No. NP_963808.1 in NCBI/protein, NEQ528
Intein aa Sequence >gi|41615310|ref|NP_963808.1|[41615310] Neq Pol-c C-terminal intein fragment (including +1 extein residue)
MRYLGKKRVILYDLSTESGKFYVNGLVLHNT
Block A
Block B
Block C None
Block D None
Block E None
Block H None
Block F ILYDLST**ESGKFYV C23
Block G NGLVLHNT C31
Initially Contributed by Fran Perler
Contributor's Address
Contributor's Phone No.
Contributor's FAX No.
Contributor's Email address
Independently Found By
Comments The Neq Pol intein is the second example of a naturally split intein potentially capable of protein trans-splicing.
Date Submitted 03/23/2004
References Waters 2003
Choi 2006

Last database update: 11/05/10

InBase Home Background Info Splicing mechanism Splicing motifs DOD Endo motifs
Intein registry Intein alleles Selected properties Blast against InBase  
Do you have an intein? Submitting data Bibliography Intein links NEB Home