| Intein Name |
Neq Pol-c |
| Prototype Allele |
Tli Pol-2 |
| Extein Name |
DNA polymerase (alpha or family B) |
| Intein Class |
Experimental |
| Organism Name |
Nanoarchaeum equitans Kin4-M |
| Organism Description |
Thermophile, taxon:228908 |
| Domain of Life |
Archaea |
| Endonuclease Activity |
|
| Endo Motif |
None |
| Location in Extein |
None |
| Insert Site Comments |
pol-c, Pol Motif C |
| Intein Size (aa) |
30 |
| Intein N-terminal |
EEGFKVIYGD/S |
| Intein C-terminal |
HN/TDSLFISGDK |
| Accession No. |
NP_963808.1 in NCBI/protein, NEQ528 |
| Intein aa Sequence |
>gi|41615310|ref|NP_963808.1|[41615310] Neq Pol-c C-terminal intein fragment (including +1 extein residue)
MRYLGKKRVILYDLSTESGKFYVNGLVLHNT |
| Block A |
|
| Block B |
|
| Block C |
None |
| Block D |
None |
| Block E |
None |
| Block H |
None |
| Block F |
ILYDLST**ESGKFYV C23 |
| Block G |
NGLVLHNT C31 |
| Initially Contributed by |
Fran Perler |
| Contributor's Address |
|
| Contributor's Phone No. |
|
| Contributor's FAX No. |
|
| Contributor's Email address |
|
| Independently Found By |
|
| Comments |
The Neq Pol intein is the second example of a naturally split intein potentially capable of protein trans-splicing. |
| Date Submitted |
03/23/2004 |
| References |
Waters 2003
Choi 2006 |
