| Intein Name | 
Nsp-PCC7120 DnaE-n | 
| Prototype Allele | 
Ssp DnaE-n | 
| Extein Name | 
DnaE pol subunit, DNA polymerase III alpha subunit | 
| Intein Class | 
Experimental | 
| Organism Name | 
Nostoc species PCC7120, (Anabaena sp. PCC7120) | 
| Organism Description | 
Cyanobacterium, Nitrogen-fixing, taxon:103690 | 
| Domain of Life | 
Eubacteria | 
| Endonuclease Activity | 
 | 
| Endo Motif | 
None | 
| Location in Extein | 
Y775 | 
| Insert Site Comments | 
dnaE-a, Beta and tau binding domains | 
| Intein Size (aa) | 
102 | 
| Intein N-terminal | 
FDDMLKFAEY/C | 
| Intein C-terminal | 
SN/CFNKSHSTAY | 
| Accession No. | 
NP_487618.1 in NCBI/protein, all3578 | 
| Intein aa Sequence | 
>gi|17231070|ref|NP_487618.1|[17231070]  Nsp-PCC7120 DnaE-n N-terminal intein fragment (including -1 extein residue)   
YCLSYDTEVLTVEYGFVPIGEIVEKGIECSVFSINNNGIVYTQPIAQWHH 
RGKQEVFEYCLEDGSIIKATKDHKFMTQDGKMLPIDEIFEQELDLLQVKG 
LPE | 
| Block A | 
CLSYDTEVLTVEY N13 | 
| Block B | 
GSIIKATKDHKFMT N76 | 
| Block C | 
None | 
| Block D | 
None | 
| Block E | 
None | 
| Block H | 
None | 
| Block F | 
 | 
| Block G | 
 | 
| Initially Contributed by | 
Fran Perler | 
| Contributor's Address | 
 | 
| Contributor's Phone No. | 
 | 
| Contributor's FAX No. | 
 | 
| Contributor's Email address | 
 | 
| Independently Found By | 
 | 
| Comments | 
This DnaE intein is a natuarlly split intein.  Homolog of the catalytic alpha subunit of E. coli DNA polymerase III.  BLOCKS A & B ARE IN Fragment N AND BLOCKS F & G ARE IN Fragment C. | 
| Date Submitted | 
07/07/2002 | 
| References | 
Kaneko 2001 
Caspi 2003 
Dassa 2007 |