New England Biolabs
To access your account, log in or register.
Products Technical Reference Customer Service My NEB Account
Contact NEB About Us Site Map Request a Catalog OEM at NEB ISO International Orders Freezer Program Quick Order
Nsp-PCC7120 DnaE-n Intein
Intein Name Nsp-PCC7120 DnaE-n
Prototype Allele Ssp DnaE-n
Extein Name DnaE pol subunit, DNA polymerase III alpha subunit
Intein Class Experimental
Organism Name Nostoc species PCC7120, (Anabaena sp. PCC7120)
Organism Description Cyanobacterium, Nitrogen-fixing, taxon:103690
Domain of Life Eubacteria
Endonuclease Activity
Endo Motif None
Location in Extein Y775
Insert Site Comments dnaE-a, Beta and tau binding domains
Intein Size (aa) 102
Intein N-terminal FDDMLKFAEY/C
Intein C-terminal SN/CFNKSHSTAY
Accession No. NP_487618.1 in NCBI/protein, all3578
Intein aa Sequence >gi|17231070|ref|NP_487618.1|[17231070] Nsp-PCC7120 DnaE-n N-terminal intein fragment (including -1 extein residue)
YCLSYDTEVLTVEYGFVPIGEIVEKGIECSVFSINNNGIVYTQPIAQWHH
RGKQEVFEYCLEDGSIIKATKDHKFMTQDGKMLPIDEIFEQELDLLQVKG
LPE
Block A CLSYDTEVLTVEY N13
Block B GSIIKATKDHKFMT N76
Block C None
Block D None
Block E None
Block H None
Block F
Block G
Initially Contributed by Fran Perler
Contributor's Address
Contributor's Phone No.
Contributor's FAX No.
Contributor's Email address
Independently Found By
Comments This DnaE intein is a natuarlly split intein. Homolog of the catalytic alpha subunit of E. coli DNA polymerase III. BLOCKS A & B ARE IN Fragment N AND BLOCKS F & G ARE IN Fragment C.
Date Submitted 07/07/2002
References Kaneko 2001
Caspi 2003
Dassa 2007

Last database update: 11/05/10

InBase Home Background Info Splicing mechanism Splicing motifs DOD Endo motifs
Intein registry Intein alleles Selected properties Blast against InBase  
Do you have an intein? Submitting data Bibliography Intein links NEB Home