Intein Name |
Ter DnaE-3c |
Prototype Allele |
Ssp DnaE-c |
Extein Name |
DnaE pol subunit, DNA polymerase III alpha subunit |
Intein Class |
Theoretical |
Organism Name |
Trichodesmium erythraeum IMS101 |
Organism Description |
Cyanobacterium, taxon:203124 |
Domain of Life |
Eubacteria |
Endonuclease Activity |
|
Endo Motif |
None |
Location in Extein |
L719 |
Insert Site Comments |
dnaE-a, Beta and tau binding domains |
Intein Size (aa) |
36 |
Intein N-terminal |
FEQMIKFAEY/C |
Intein C-terminal |
SN/CFNKSHSTAY |
Accession No. |
ABG51160 in NCBI/protein, Tery_1905, Tery3371 |
Intein aa Sequence |
>gi|23042722|ref|ZP_00074086.1| gi|110166620|gb|ABG51160.1|| Ter DnaE-3c C-terminal intein fragment (including +1 extein residue)
MVKIVSRKLAKTENVYDIGVTKDHNFVLANGLIASNC |
Block A |
|
Block B |
|
Block C |
None |
Block D |
None |
Block E |
None |
Block H |
None |
Block F |
NVYDIGV**TKDHNFV C27 |
Block G |
NGLIASNC C37 |
Initially Contributed by |
Paul Liu |
Contributor's Address |
|
Contributor's Phone No. |
|
Contributor's FAX No. |
|
Contributor's Email address |
|
Independently Found By |
|
Comments |
This DnaE intein is a natuarlly split intein. Homolog of the catalytic alpha subunit of E. coli DNA polymerase III.
BLOCKS A & B ARE IN Fragment N AND BLOCKS F & G ARE IN Fragment C.
This sequence replaces the previous genome shotgun sequence submitted by Paul Liu to InBase from ZP_00075043.1 in NCBI/protein, Tery4385. This new sequence is identical to the previous sequence. |
Date Submitted |
04/28/2003 |
References |
Liu 2003
Caspi 2003 |