New England Biolabs
To access your account, log in or register.
Products Technical Reference Customer Service My NEB Account
Contact NEB About Us Site Map Request a Catalog OEM at NEB ISO International Orders Freezer Program Quick Order
Cwa DnaE-n Intein
Intein Name Cwa DnaE-n
Prototype Allele Ssp DnaE-n
Extein Name DnaE pol subunit, DNA polymerase III alpha subunit
Intein Class Theoretical
Organism Name Crocosphaera watsonii WH 8501 (Synechocystis sp. WH 8501)
Organism Description Cyanobacterium, taxon:165597
Domain of Life Eubacteria
Endonuclease Activity
Endo Motif None
Location in Extein Y774
Insert Site Comments dnaE-a, Beta and tau binding domains
Intein Size (aa) 106
Intein N-terminal FEQMIKFAEY/C
Intein C-terminal SN/CFNKSHSTAY
Accession No. ZP_00177853 in NCBI/protein, Cwat03002353
Intein aa Sequence >gi|45526650|ref|ZP_00177853.1|[45526650] Cwa DnaE-n N-terminal intein fragment (including -1 extein residue)
YCLSYDTEILTVEYGAMYIGKIVEENINCTVYTVDKNGFVYTQTIAQWHNRGEQEIFEYDLEDGSKIKATKDHKFMTIDG
EMLPIDEIFEKNLDLKQVVSHPDDYLV
Block A CLSYDTEILTVEY N13
Block B GSKIKATKDHKFMT N76
Block C None
Block D None
Block E None
Block H None
Block F
Block G
Initially Contributed by Fran Perler
Contributor's Address
Contributor's Phone No.
Contributor's FAX No.
Contributor's Email address
Independently Found By
Comments This DnaE intein is a natuarlly split intein. Homolog of the catalytic alpha subunit of E. coli DNA polymerase III. BLOCKS A & B ARE IN Fragment N AND BLOCKS F & G ARE IN Fragment C.
Date Submitted 03/03/2005
References

Last database update: 11/05/10

InBase Home Background Info Splicing mechanism Splicing motifs DOD Endo motifs
Intein registry Intein alleles Selected properties Blast against InBase  
Do you have an intein? Submitting data Bibliography Intein links NEB Home