| Intein Name |
Tko CDC21-2 |
| Prototype Allele |
Tko CDC21-2 |
| Extein Name |
Cell division control protein 21 |
| Intein Class |
Theoretical |
| Organism Name |
Thermococcus kodakaraensis KOD1 |
| Organism Description |
Thermophile, taxon:69014 |
| Domain of Life |
Archaea |
| Endonuclease Activity |
|
| Endo Motif |
|
| Location in Extein |
Q553 |
| Insert Site Comments |
CDC21-c |
| Intein Size (aa) |
335 |
| Intein N-terminal |
SAIHEALEQQ/S |
| Intein C-terminal |
HN/TISISKAGIT |
| Accession No. |
YP_184033 in NCBI/protein, TK1620 |
| Intein aa Sequence |
>gi|57641555|ref|YP_184033.1|[57641555] Tko CDC21-2 intein (including -1 and +1 extein residues)
QSYHHDFELLLADGRKVKIGELVDKLIEKNRDRVILGKDTEILPVEDIELLAYDLEKREIVKVKADRVSRHKAPERFIKL
RFSNGREITVTPEHPVMVWENGEITEKPAEKITPGDIALGVLRYPIQVDGKFKERYRDMREAEDYQDYLYSRGVVSKIKR
TGIYFTVEKARRALPRELVKPLINAGKILRVTQTPKERASFNQKLVRENIIEGYLQRIIERMDELERLSREDPAKALELL
PKTQLYYKYGITYGKLKKLAEARNSWAEGIIQSAVAERISLAKRELEEFFKWWNANVNFLKVKCVEEIKNDRWEWVYDVT
VEPHHLFVSHGLVLHNT |
| Block A |
SYHHDFELLLADG 13 |
| Block B |
GREITVTPEHPVMV 97 |
| Block C |
|
| Block D |
|
| Block E |
|
| Block H |
|
| Block F |
WVYDVTV**EPHHLFV 327 |
| Block G |
HGLVLHNT 336 |
| Initially Contributed by |
Fran Perler |
| Contributor's Address |
|
| Contributor's Phone No. |
|
| Contributor's FAX No. |
|
| Contributor's Email address |
|
| Independently Found By |
|
| Comments |
Formly called Pyrococcus kodakaraensis. DNA replication licensing factor, MCM2/3/5 family |
| Date Submitted |
02/28/2005 |
| References |
Fukui 2005 |