| Intein Name |
Nfe-NRRL5534 PRP8 |
| Prototype Allele |
Cne-AD PRP8 |
| Extein Name |
PRP8, pre-mRNA splicing factor |
| Intein Class |
Theoretical |
| Organism Name |
Neosartorya fennelliae NRRL 5534 |
| Organism Description |
Fungus, taxon:41048 |
| Domain of Life |
Eucarya |
| Endonuclease Activity |
|
| Endo Motif |
None |
| Location in Extein |
A? |
| Insert Site Comments |
PRP8-a, same as A1578 in Sce PRP8 |
| Intein Size (aa) |
155 |
| Intein N-terminal |
SWEGLFWERA/C |
| Intein C-terminal |
HN/SGFEESMKFK |
| Accession No. |
ABC00918 in NCBI/Protein |
| Intein aa Sequence |
>gi|83274383|gb|ABC00918.1|[83274383] Nfe-NRRL5534 PRP8 intein (including -1 and +1 extein residues)
ACLAKGTRLLRYDGSEIEVQDVKEGDLLLGPDGGPRRAFNIVSGEDRLYRIKIDGSVEDLVVTPNHILVLHREKATDSYD
TVEMTAAEFATLSAEERGRYRAFRSPSFELSEKAVSVNHRFMIKDIRLELEATEWAGFRVDKDQLYLRHDYLVLHNS |
| Block A |
CLAKGTRLLRYDG 13 |
| Block B |
VEDLVVTPNHILVL 69 |
| Block C |
None |
| Block D |
None |
| Block E |
None |
| Block H |
None |
| Block F |
ATEWAGFRVDKDQLYL 146 |
| Block G |
DYLVLHNS 156 |
| Initially Contributed by |
Dhiraj Sharma |
| Contributor's Address |
Bioinformatics Research Lab.
IBI Biosolutions Pvt. Ltd.
Panchkula - 134109
Haryana, INDIA |
| Contributor's Phone No. |
|
| Contributor's FAX No. |
|
| Contributor's Email address |
dhirajsharma@ibibiosolutions.com |
| Independently Found By |
|
| Comments |
|
| Date Submitted |
01/01/2008 |
| References |
Butler 2006 |