New England Biolabs
To access your account, log in or register.
Products Technical Reference Customer Service My NEB Account
Contact NEB About Us Site Map Request a Catalog OEM at NEB ISO International Orders Freezer Program Quick Order
Tel DnaE-n Intein
Intein Name Tel DnaE-n
Prototype Allele Ssp DnaE-n
Extein Name DnaE pol subunit, DNA polymerase III alpha subunit
Intein Class Theoretical
Organism Name Thermosynechococcus elongatus BP-1
Organism Description Cyanobacterium,
Domain of Life Eubacteria
Endonuclease Activity
Endo Motif None
Location in Extein Y755
Insert Site Comments dnaE-a, Beta and tau binding domains
Intein Size (aa) 118
Intein N-terminal FKQMLDFAEY/C
Intein C-terminal AN/CFNKSHSTAY
Accession No. NP_682846.1 in NCBI/protein, tll2056
Intein aa Sequence >gi|22299599|ref|NP_682846.1|[22299599] Tel DnaE-n N-terminal intein fragment (including -1 extein residue)
YCLSGETAVMTVEYGAVPIRRLVQERLSCHVYSLDGQGHLYTQPIAQWHFQGFRPVYEYQ
LEDGSTICATPDHRFMTTRGQMLPIEQIFQEGLELWQVAIAPRQALLQGLKPAVQMSG
Block A CLSGETAVMTVEY N13
Block B GSTICATPDHRFMT N76
Block C None
Block D None
Block E None
Block H None
Block F
Block G
Initially Contributed by Fran Perler
Contributor's Address
Contributor's Phone No.
Contributor's FAX No.
Contributor's Email address
Independently Found By
Comments This DnaE intein is a natuarlly split intein. Homolog of the catalytic alpha subunit of E. coli DNA polymerase III. NOTE THAT BLOCKS A & B ARE IN Fragment N AND BLOCKS F & G ARE IN Fragment C.
Date Submitted 04/28/2003
References Nakamura 2002A
Nakamura 2002B
Caspi 2003

Last database update: 11/05/10

InBase Home Background Info Splicing mechanism Splicing motifs DOD Endo motifs
Intein registry Intein alleles Selected properties Blast against InBase  
Do you have an intein? Submitting data Bibliography Intein links NEB Home