| Intein Name |
Ssp DnaE-n |
| Prototype Allele |
Ssp DnaE-n |
| Extein Name |
DnaE pol subunit, DNA polymerase III alpha subunit |
| Intein Class |
Experimental |
| Organism Name |
Synechocystis species, strain PCC6803 |
| Organism Description |
Cyanobacterium, taxon:1148 |
| Domain of Life |
Eubacteria |
| Endonuclease Activity |
|
| Endo Motif |
None |
| Location in Extein |
Y774 |
| Insert Site Comments |
dnaE-a, Beta and tau binding domains |
| Intein Size (aa) |
123 |
| Intein N-terminal |
FDQMVKFAEY/C |
| Intein C-terminal |
AN/CFNKSHSTAY |
| Accession No. |
S76958 in NCBI/protein, slr0603 |
| Intein aa Sequence |
>gi|7438168|pir||S76958[7438168] Ssp DnaE-n N-terminal intein fragment (including -1 extein residue)
YCLSFGTEILTVEYGPLPIGKIVSEEINCSVYSVDPEGRVYTQAIAQWHDRGEQEVLEYELEDGSVIR
ATSDHRFLTTDYQLLAIEEIFARQLDLLTLENIKQTEEALDNHRLPFPLLDAGTIK |
| Block A |
CLSFGTEILTVEY N13 |
| Block B |
GSVIRATSDHRFLT N76 |
| Block C |
None |
| Block D |
None |
| Block E |
None |
| Block H |
None |
| Block F |
|
| Block G |
|
| Initially Contributed by |
Paul Xiang-Qin Liu |
| Contributor's Address |
Biochemistry Department
Dalhousie University
Halifax, Nova Scotia B3H 4H7
Canada |
| Contributor's Phone No. |
902-494-1208 |
| Contributor's FAX No. |
902-494-1355 |
| Contributor's Email address |
pxqliu@dal.ca |
| Independently Found By |
Independently identified as a theoretical intein in Gorbalenya 98. |
| Comments |
The Ssp DnaE intein is a split intein capable of protein trans-splicing. Homolog of the catalytic alpha subunit of E. coli DNA polymerase III. The C-terminal penultimate His residue is replaced by Ala.
See AF545504.1 which is optimized for plant codons (Yang 03).BLOCKS A & B ARE IN Fragment N AND BLOCKS F & G ARE IN Fragment C. |
| Date Submitted |
06/10/1998 |
| References |
Kaneko 1995
Keneko 1995B
Kaneko 1996
Kaneko 1996B
Kaneko 1997
Gorbalenya 1998
Wu 1998
Perler 1999B
Scott 1999
Evans 2000
Ozawa 2000
Martin 2001
Chen 2001
Sun 2001
Iwai 2001
Mills 2001
Ghosh 2001
Ozawa 2001
Chen 2002B
Nichols 2003
Yang 2003
Chin 2003
Caspi 2003
Ozawa 2005
Zuger 2005
Iwai 2006
Aranko 2009 |
