| Intein Name |
Sel-PCC6301 DnaE-c |
| Prototype Allele |
Ssp DnaE-c |
| Extein Name |
DnaE pol subunit, DNA polymerase III alpha subunit |
| Intein Class |
Theoretical |
| Organism Name |
Synechococcus elongatus PCC 6301 and PCC7942 |
| Organism Description |
Cyanobacterium, taxon:269084,"Berkely strain 6301~equivalent name: Synechococcus
sp. PCC 6301~synonym: Anacystis nudulans" |
| Domain of Life |
Eubacteria |
| Endonuclease Activity |
|
| Endo Motif |
None |
| Location in Extein |
None |
| Insert Site Comments |
dnaE-a, Beta and tau binding domains |
| Intein Size (aa) |
36 |
| Intein N-terminal |
FDQMVLFAEY/C |
| Intein C-terminal |
SN/CFNKSHSTAY |
| Accession No. |
YP_171662 in NCBI/protein, syc0952_d |
| Intein aa Sequence |
>gi|56750961|ref|YP_171662.1|[56750961] | Sel-PCC6301 DnaE-c C-terminal intein fragment (including +1 extein residues)
MVKIVRRRSLGVQPVYDLGVATVHNFVLANGLVASNC |
| Block A |
|
| Block B |
|
| Block C |
None |
| Block D |
None |
| Block E |
None |
| Block H |
None |
| Block F |
PVYDLGV**ATVHNFV C27 |
| Block G |
NGLVASNC C37 |
| Initially Contributed by |
Fran Perler |
| Contributor's Address |
|
| Contributor's Phone No. |
|
| Contributor's FAX No. |
|
| Contributor's Email address |
|
| Independently Found By |
|
| Comments |
This DnaE intein is a natuarlly split intein. Homolog of the catalytic alpha subunit of E. coli DNA polymerase III. BLOCKS A & B ARE IN Fragment N AND BLOCKS F & G ARE IN Fragment C.
Same amino acid sequence in Sel-PCC7942: ZP_00202306 &ZP_00163365 |
| Date Submitted |
02/22/2005 |
| References |
Caspi 2003 |
